Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)
Catalog Number:
CSB-CF002326MO
- Images (0)
| Article Name: | Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1) |
| Biozol Catalog Number: | CSB-CF002326MO |
| Supplier Catalog Number: | CSB-CF002326MO |
| Alternative Catalog Number: | CSB-CF002326MO-100, CSB-CF002326MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Sodium/potassium-dependent ATPase subunit beta-1) |
| Molecular Weight: | 36.7 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P14094 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-304aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPK |
Product Guarantee and Expert Support
