Recombinant Human Vasopressin V1b receptor (AVPR1B)
Catalog Number:
CSB-CF002469HU(A4)
- Images (0)
| Article Name: | Recombinant Human Vasopressin V1b receptor (AVPR1B) |
| Biozol Catalog Number: | CSB-CF002469HU(A4) |
| Supplier Catalog Number: | CSB-CF002469HU(A4) |
| Alternative Catalog Number: | CSB-CF002469HU(A4)-100, CSB-CF002469HU(A4)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (V1bR)(AVPR V1b)(AVPR V3)(Antidiuretic hormone receptor 1b)(Vasopressin V3 receptor),CSB-PR2024 |
| Molecular Weight: | 53.0 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P47901 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-424aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPST |
Product Guarantee and Expert Support
