Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3), partial
Catalog Number:
CSB-CF002766MO2
- Images (0)
| Article Name: | Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3), partial |
| Biozol Catalog Number: | CSB-CF002766MO2 |
| Supplier Catalog Number: | CSB-CF002766MO2 |
| Alternative Catalog Number: | CSB-CF002766MO2-100, CSB-CF002766MO2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Nip3,CSB-PR2024 |
| Molecular Weight: | 21.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O55003 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 50-187aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF |
Product Guarantee and Expert Support
