Recombinant Mouse C-C chemokine receptor type 1 (Ccr1)

Product Overview

• Article Name: Recombinant Mouse C-C chemokine receptor type 1 (Ccr1)
• Biozol Catalog Number: CSB-CF004839MO
• Supplier Catalog Number: CSB-CF004839MO
• Alternative Catalog Number: CSB-CF004839MO-100, CSB-CF004839MO-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (C-C CKR-1)(CC-CKR-1)(CCR-1)(CCR1)(Macrophage inflammatory protein 1-alpha receptor)(MIP-1alpha-R)(RANTES-R)(CD antigen CD191),CSB-PR2024

Product Properties

• Molecular Weight: 43.7 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P51675
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 1-355aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTP