Recombinant Human C-C chemokine receptor type 5 (CCR5)
Catalog Number:
CSB-CF004844HU
- Images (0)
| Article Name: | Recombinant Human C-C chemokine receptor type 5 (CCR5) |
| Biozol Catalog Number: | CSB-CF004844HU |
| Supplier Catalog Number: | CSB-CF004844HU |
| Alternative Catalog Number: | CSB-CF004844HU-100, CSB-CF004844HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CHEMR13 (HIV-1 fusion coreceptor) (CD_antigen: CD195) (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (CMKBR5) |
| Molecular Weight: | 43.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P51681 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-352aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIV |
Product Guarantee and Expert Support
