Recombinant Human C-C chemokine receptor type 6 (CCR6)
Catalog Number:
CSB-CF004845HUA2
- Images (0)
| Article Name: | Recombinant Human C-C chemokine receptor type 6 (CCR6) |
| Biozol Catalog Number: | CSB-CF004845HUA2 |
| Supplier Catalog Number: | CSB-CF004845HUa2 |
| Alternative Catalog Number: | CSB-CF004845HUA2-100, CSB-CF004845HUA2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Chemokine receptor-like 3 |
| Molecular Weight: | 58.5 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P51684 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-374aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIR |
Product Guarantee and Expert Support
