Recombinant Human C-C chemokine receptor type 8 (CCR8)

Product Overview

• Article Name: Recombinant Human C-C chemokine receptor type 8 (CCR8)
• Biozol Catalog Number: CSB-CF004847HU
• Supplier Catalog Number: CSB-CF004847HU
• Alternative Catalog Number: CSB-CF004847HU-100, CSB-CF004847HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: CC chemokine receptor CHEMR1 CMKBRL2 Chemokine receptor-like 1 Short name: CKR-L1 GPR-CY6 Short name: GPRCY6 TER1 CD_antigen: CDw198

Product Properties

• Molecular Weight: 41.7 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P51685
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 1-355aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPF