Recombinant Human C-C chemokine receptor type 8 (CCR8), partial

Catalog Number: CSB-CF004847HU2
Article Name: Recombinant Human C-C chemokine receptor type 8 (CCR8), partial
Biozol Catalog Number: CSB-CF004847HU2
Supplier Catalog Number: CSB-CF004847HU2
Alternative Catalog Number: CSB-CF004847HU2-100, CSB-CF004847HU2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CC chemokine receptor CHEMR1,CMKBRL2Chemokine receptor-like 1,CKR-L1,GPR-CY6,GPRCY6,TER1,CDw198
Molecular Weight: 9.4 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P51685
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 74-129aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV