Recombinant Human CD63 antigen (CD63)

Product Overview

• Article Name: Recombinant Human CD63 antigen (CD63)
• Biozol Catalog Number: CSB-CF004950HU
• Supplier Catalog Number: CSB-CF004950HU
• Alternative Catalog Number: CSB-CF004950HU-100, CSB-CF004950HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Granulophysin Lysosomal-associated membrane protein 3 Short name: LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name: Tspan-30 CD_antigen: CD63 MLA1, TSPAN30

Product Properties

• Molecular Weight: 31.5 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P08962
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 2-238aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM