Recombinant Human CLIP-associating protein 2 (CLASP2)
Catalog Number:
CSB-CF005472HU
- Images (0)
| Article Name: | Recombinant Human CLIP-associating protein 2 (CLASP2) |
| Biozol Catalog Number: | CSB-CF005472HU |
| Supplier Catalog Number: | CSB-CF005472HU |
| Alternative Catalog Number: | CSB-CF005472HU-100, CSB-CF005472HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cytoplasmic linker-associated protein 2 Protein Orbit homolog 2 Short name: hOrbit2 |
| Molecular Weight: | 60.5 kDa |
| Tag: | N-terminal 6xHis-B2M-tagged |
| UniProt: | O75122 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-431aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSL |
Product Guarantee and Expert Support
