Recombinant Human Claudin-4 (CLDN4)
Catalog Number:
CSB-CF005506HU
- Images (0)
| Article Name: | Recombinant Human Claudin-4 (CLDN4) |
| Biozol Catalog Number: | CSB-CF005506HU |
| Supplier Catalog Number: | CSB-CF005506HU |
| Alternative Catalog Number: | CSB-CF005506HU-100, CSB-CF005506HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Clostridium perfringens enterotoxin receptor,CPE-R,CPE-receptor,Williams-Beuren syndrome chromosomal region 8 protein |
| Molecular Weight: | 28.1 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O14493 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-209aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Product Guarantee and Expert Support
