Recombinant Human Chemerin-like receptor 1 (CMKLR1)
Catalog Number:
CSB-CF005614HUD7
- Images (0)
| Article Name: | Recombinant Human Chemerin-like receptor 1 (CMKLR1) |
| Biozol Catalog Number: | CSB-CF005614HUD7 |
| Supplier Catalog Number: | CSB-CF005614HUd7 |
| Alternative Catalog Number: | CSB-CF005614HUD7-100, CSB-CF005614HUD7-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Chemokine-like receptor 1,G-protein coupled receptor ChemR23,G-protein coupled receptor DEZ,CSB-PR2024 |
| Molecular Weight: | 43.7 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q99788 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-373aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAK |
Product Guarantee and Expert Support
