Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

Product Overview

• Article Name: Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
• Biozol Catalog Number: CSB-CF006254HU
• Supplier Catalog Number: CSB-CF006254HU
• Alternative Catalog Number: CSB-CF006254HU-100, CSB-CF006254HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor Short name: LESTR Lipopolysaccharide-associated protein 3 Short name: LAP-3 Short name: LPS-associated protein 3 NPYRL Stromal cell-derived factor 1 receptor Short name: SDF-1 rec

Product Properties

• Molecular Weight: 56.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P61073
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 1-356aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA