Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)

Catalog Number: CSB-CF006254HUA0
Article Name: Recombinant Human C-X-C chemokine receptor type 4 (CXCR4)
Biozol Catalog Number: CSB-CF006254HUA0
Supplier Catalog Number: CSB-CF006254HUa0
Alternative Catalog Number: CSB-CF006254HUA0-100, CSB-CF006254HUA0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FB22 Fusin HM89 LCR1 Leukocyte-derived seven transmembrane domain receptor
Molecular Weight: 44.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P61073
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-356aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA