Recombinant Human Atypical chemokine receptor 3 (ACKR3)

Product Overview

• Article Name: Recombinant Human Atypical chemokine receptor 3 (ACKR3)
• Biozol Catalog Number: CSB-CF006257HU(A4)
• Supplier Catalog Number: CSB-CF006257HU(A4)
• Alternative Catalog Number: CSB-CF006257HU(A4)-100, CSB-CF006257HU(A4)-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: C-X-C chemokine receptor type 7 Short name: CXC-R7 Short name: CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name: RDC-1

Product Properties

• Molecular Weight: 57.5 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P25106
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 1-362aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKII