Recombinant Human Diacylglycerol kinase epsilon (DGKE)

Catalog Number: CSB-CF006835HU
Article Name: Recombinant Human Diacylglycerol kinase epsilon (DGKE)
Biozol Catalog Number: CSB-CF006835HU
Supplier Catalog Number: CSB-CF006835HU
Alternative Catalog Number: CSB-CF006835HU-100, CSB-CF006835HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Diglyceride kinase epsilon
Molecular Weight: 83.9 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: P52429
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-567aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEFRILLNPVQVFDVTK