Recombinant Human Endothelin-1 receptor (EDNRA) Preis auf Anfrage

Catalog Number: CSB-CF007403HU
Article Name: Recombinant Human Endothelin-1 receptor (EDNRA) Preis auf Anfrage
Biozol Catalog Number: CSB-CF007403HU
Supplier Catalog Number: CSB-CF007403HU
Alternative Catalog Number: CSB-CF007403HU-100,CSB-CF007403HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Endothelin A receptor
Molecular Weight: 48.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P25101
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 21-427aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIF
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.