Recombinant Human Endothelin receptor type B (EDNRB) (Active)
Catalog Number:
CSB-CF007404HU
- Images (0)
| Article Name: | Recombinant Human Endothelin receptor type B (EDNRB) (Active) |
| Biozol Catalog Number: | CSB-CF007404HU |
| Supplier Catalog Number: | CSB-CF007404HU |
| Alternative Catalog Number: | CSB-CF007404HU-100, CSB-CF007404HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Endothelin receptor non-selective type |
| Molecular Weight: | 48.8 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | P24530 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 27-442aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSF |
Product Guarantee and Expert Support
