Recombinant Human Erlin-1 (ERLIN1)
Catalog Number:
CSB-CF007790HU
- Images (0)
| Article Name: | Recombinant Human Erlin-1 (ERLIN1) |
| Biozol Catalog Number: | CSB-CF007790HU |
| Supplier Catalog Number: | CSB-CF007790HU |
| Alternative Catalog Number: | CSB-CF007790HU-100, CSB-CF007790HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Endoplasmic reticulum lipid raft-associated protein 1 Protein KE04 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1 Short name: SPFH domain-containing protein 1,CSB-PR2024 |
| Molecular Weight: | 42.0 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O75477 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-348aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNMTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEAIRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKETEKRISEIEDAAFLA |
Product Guarantee and Expert Support
