Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial
Catalog Number:
CSB-CF008434MOV2
- Images (0)
| Article Name: | Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6 (FASLG), partial |
| Biozol Catalog Number: | CSB-CF008434MOV2 |
| Supplier Catalog Number: | CSB-CF008434MOV2 |
| Alternative Catalog Number: | CSB-CF008434MOV2-100, CSB-CF008434MOV2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen: CD178) (CD95L) (FASL) (TNFSF6) |
| Molecular Weight: | 18.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P63308 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 102-211aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY |
Product Guarantee and Expert Support
