Recombinant Human Galactocerebrosidase (GALC)
Catalog Number:
CSB-CF009196HU(F1)B0
- Images (0)
| Article Name: | Recombinant Human Galactocerebrosidase (GALC) |
| Biozol Catalog Number: | CSB-CF009196HU(F1)B0 |
| Supplier Catalog Number: | CSB-CF009196HU(F1)b0 |
| Alternative Catalog Number: | CSB-CF009196HU(F1)B0-100, CSB-CF009196HU(F1)B0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | GALCERase,Galactocerebroside beta-galactosidase,Galactosylceramidase,Galactosylceramide beta-galactosidase,CSB-PR2024 |
| Molecular Weight: | 75.0 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P54803 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 43-685aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LVPRGSYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGR |
Product Guarantee and Expert Support
