Recombinant Mouse Galactocerebrosidase (Galc)
Catalog Number:
CSB-CF009196MO
- Images (0)
| Article Name: | Recombinant Mouse Galactocerebrosidase (Galc) |
| Biozol Catalog Number: | CSB-CF009196MO |
| Supplier Catalog Number: | CSB-CF009196MO |
| Alternative Catalog Number: | CSB-CF009196MO-100, CSB-CF009196MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (GALCERase)(Galactocerebroside beta-galactosidase)(Galactosylceramidase)(Galactosylceramide beta-galactosidase),CSB-PR2024 |
| Molecular Weight: | 73.1 kDa |
| Tag: | Tag-Free |
| UniProt: | P54818 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 43-684aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNY |
Product Guarantee and Expert Support
