Recombinant Bovine Gap junction alpha-1 protein(GJA1)
Catalog Number:
CSB-CF009443BO
- Images (0)
| Article Name: | Recombinant Bovine Gap junction alpha-1 protein(GJA1) |
| Biozol Catalog Number: | CSB-CF009443BO |
| Supplier Catalog Number: | CSB-CF009443BO |
| Alternative Catalog Number: | CSB-CF009443BO-100, CSB-CF009443BO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Connexin-43 (Cx43),Vascular smooth muscle connexin-43 |
| Molecular Weight: | 44.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P18246 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 2-383aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVVAQTDGANVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHTTTGPL |
Product Guarantee and Expert Support
