Recombinant Human Glycophorin-B (GYPB)
Catalog Number:
CSB-CF010075HU
- Images (0)
| Article Name: | Recombinant Human Glycophorin-B (GYPB) |
| Biozol Catalog Number: | CSB-CF010075HU |
| Supplier Catalog Number: | CSB-CF010075HU |
| Alternative Catalog Number: | CSB-CF010075HU-100, CSB-CF010075HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | PAS-3 SS-active sialoglycoprotein Sialoglycoprotein delta CD_antigen: CD235b,CSB-PR2024 |
| Molecular Weight: | 10.5 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P06028 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 20-91aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA |
Product Guarantee and Expert Support
