Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)

Catalog Number: CSB-CF010882HUB0
Article Name: Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)
Biozol Catalog Number: CSB-CF010882HUB0
Supplier Catalog Number: CSB-CF010882HUb0
Alternative Catalog Number: CSB-CF010882HUB0-100, CSB-CF010882HUB0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: S12 Serotonin 1D beta receptor
Molecular Weight: 45.1 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P28222
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-390aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRA