Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B)
Catalog Number:
CSB-CF010882HUB0
- Images (0)
| Article Name: | Recombinant Human 5-hydroxytryptamine receptor 1B (HTR1B) |
| Biozol Catalog Number: | CSB-CF010882HUB0 |
| Supplier Catalog Number: | CSB-CF010882HUb0 |
| Alternative Catalog Number: | CSB-CF010882HUB0-100, CSB-CF010882HUB0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | S12 Serotonin 1D beta receptor |
| Molecular Weight: | 45.1 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P28222 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-390aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRA |
Product Guarantee and Expert Support
