Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E), partial
Catalog Number:
CSB-CF010894HU
- Images (0)
| Article Name: | Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E), partial |
| Biozol Catalog Number: | CSB-CF010894HU |
| Supplier Catalog Number: | CSB-CF010894HU |
| Alternative Catalog Number: | CSB-CF010894HU-100, CSB-CF010894HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Serotonin receptor 3E |
| Molecular Weight: | 58.2 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | A5X5Y0 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 72-229aa & 241-456aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVA |
Product Guarantee and Expert Support
