Recombinant Human 5-hydroxytryptamine receptor 7 (HTR7)
Catalog Number:
CSB-CF010899HU
- Images (0)
| Article Name: | Recombinant Human 5-hydroxytryptamine receptor 7 (HTR7) |
| Biozol Catalog Number: | CSB-CF010899HU |
| Supplier Catalog Number: | CSB-CF010899HU |
| Alternative Catalog Number: | CSB-CF010899HU-100, CSB-CF010899HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 5-HT-X Serotonin receptor 7 |
| Molecular Weight: | 56.4 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P34969 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-479aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSV |
Product Guarantee and Expert Support
