Recombinant Human Interleukin-1 receptor type 1 (IL1R1)
Catalog Number:
CSB-CF011621HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-1 receptor type 1 (IL1R1) |
| Biozol Catalog Number: | CSB-CF011621HU |
| Supplier Catalog Number: | CSB-CF011621HU |
| Alternative Catalog Number: | CSB-CF011621HU-100, CSB-CF011621HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CD121 antigen-like family member A Interleukin-1 receptor alpha |
| Molecular Weight: | 83.5 kDa |
| Tag: | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| UniProt: | P14778 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 18-569aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDD |
Product Guarantee and Expert Support
