Recombinant Human Interleukin-7 (IL7)
Catalog Number:
CSB-CF011669HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-7 (IL7) |
| Biozol Catalog Number: | CSB-CF011669HU |
| Supplier Catalog Number: | CSB-CF011669HU |
| Alternative Catalog Number: | CSB-CF011669HU-100, CSB-CF011669HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | IL 7, IL-7, Il7, IL7_HUMAN, Interleukin 7, Interleukin-7, LP-1, Lymphopoietin 1 |
| Molecular Weight: | 33.4 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P13232 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 26-177aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Product Guarantee and Expert Support
