Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)

Catalog Number: CSB-CF012048RAA0
Article Name: Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)
Biozol Catalog Number: CSB-CF012048RAA0
Supplier Catalog Number: CSB-CF012048RAa0
Alternative Catalog Number: CSB-CF012048RAA0-100, CSB-CF012048RAA0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (ATP-sensitive inward rectifier potassium channel KAB-2)(BIR10)(Brain-specific inwardly rectifying K(+) channel 1)(BIRK1)(Inward rectifier K(+) channel Kir4.1)(Potassium channel, inwardly rectifying subfamily J member 10),CSB-PR2024
Molecular Weight: 46.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P49655
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-379aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLT