Recombinant Human Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)

Product Overview

• Article Name: Recombinant Human Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)
• Biozol Catalog Number: CSB-CF012087HU
• Supplier Catalog Number: CSB-CF012087HU
• Alternative Catalog Number: CSB-CF012087HU-100, CSB-CF012087HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1,KQT-like 1,Voltage-gated potassium channel subunit Kv7.1

Product Properties

• Molecular Weight: 80.7 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: P51787
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 1-676aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPGAPGPAPPASPAAPAAPPVASDLGPRPPVSLDPRVSIYSTRRPVLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSV