Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)

Catalog Number: CSB-CF012807HU
Article Name: Recombinant Human Lysocardiolipin acyltransferase 1 (LCLAT1)
Biozol Catalog Number: CSB-CF012807HU
Supplier Catalog Number: CSB-CF012807HU
Alternative Catalog Number: CSB-CF012807HU-100, CSB-CF012807HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (1-acylglycerol-3-phosphate O-acyltransferase 8)(1-AGP acyltransferase 8)(1-AGPAT 8)(Acyl-CoA:lysocardiolipin acyltransferase 1),CSB-PR2024
Molecular Weight: 55.0 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q6UWP7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-414aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MHSRGREIVVLLNPWSINEAVSSYCTYFIKQDSKSFGIMVSWKGIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAV