Recombinant Human Mitofusin-2 (MFN2)
Catalog Number:
CSB-CF013756HU
- Images (0)
| Article Name: | Recombinant Human Mitofusin-2 (MFN2) |
| Biozol Catalog Number: | CSB-CF013756HU |
| Supplier Catalog Number: | CSB-CF013756HU |
| Alternative Catalog Number: | CSB-CF013756HU-100, CSB-CF013756HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Transmembrane GTPase MFN2) |
| Molecular Weight: | 87.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O95140 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-757aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIF |
Product Guarantee and Expert Support
