Recombinant Human NADPH oxidase 1 (NOX1)
Catalog Number:
CSB-CF015959HU
- Images (0)
| Article Name: | Recombinant Human NADPH oxidase 1 (NOX1) |
| Biozol Catalog Number: | CSB-CF015959HU |
| Supplier Catalog Number: | CSB-CF015959HU |
| Alternative Catalog Number: | CSB-CF015959HU-100, CSB-CF015959HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Mitogenic oxidase 1 (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1) |
| Molecular Weight: | 67.7 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9Y5S8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-564aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRD |
Product Guarantee and Expert Support
