Recombinant Human NADPH oxidase 4 (NOX4)
Catalog Number:
CSB-CF015961HU
- Images (0)
| Article Name: | Recombinant Human NADPH oxidase 4 (NOX4) |
| Biozol Catalog Number: | CSB-CF015961HU |
| Supplier Catalog Number: | CSB-CF015961HU |
| Alternative Catalog Number: | CSB-CF015961HU-100, CSB-CF015961HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Kidney oxidase-1 (KOX-1) (Kidney superoxide-producing NADPH oxidase) (Renal NAD(P)H-oxidase) (RENOX) |
| Molecular Weight: | 69.8 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q9NPH5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-578aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEG |
Product Guarantee and Expert Support
