Recombinant Pongo abelii NADPH oxidase 4 (NOX4)

Catalog Number: CSB-CF015961PYX
Article Name: Recombinant Pongo abelii NADPH oxidase 4 (NOX4)
Biozol Catalog Number: CSB-CF015961PYX
Supplier Catalog Number: CSB-CF015961PYX
Alternative Catalog Number: CSB-CF015961PYX-100, CSB-CF015961PYX-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ,CSB-PR2024
Molecular Weight: 69.7 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q5R5C5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-578aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEG