Recombinant Human Delta-type opioid receptor (OPRD1)

Catalog Number: CSB-CF016358HU
Article Name: Recombinant Human Delta-type opioid receptor (OPRD1)
Biozol Catalog Number: CSB-CF016358HU
Supplier Catalog Number: CSB-CF016358HU
Alternative Catalog Number: CSB-CF016358HU-100, CSB-CF016358HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (D-OR-1)(DOR-1)
Molecular Weight: 41.9 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P41143
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-372aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDR