Recombinant Human Mu-type opioid receptor (OPRM1)

Catalog Number: CSB-CF016361HU
Article Name: Recombinant Human Mu-type opioid receptor (OPRM1)
Biozol Catalog Number: CSB-CF016361HU
Supplier Catalog Number: CSB-CF016361HU
Alternative Catalog Number: CSB-CF016361HU-100, CSB-CF016361HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Mu-type opioid receptor(M-OR-1)(MOR-1)(Mu opiate receptor)(Mu opioid receptor)(MOP)(hMOP)
Molecular Weight: 47.6 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P35372
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-400aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCY