Recombinant Mouse P2Y purinoceptor 1 (P2ry1)

Catalog Number: CSB-CF017326MO
Article Name: Recombinant Mouse P2Y purinoceptor 1 (P2ry1)
Biozol Catalog Number: CSB-CF017326MO
Supplier Catalog Number: CSB-CF017326MO
Alternative Catalog Number: CSB-CF017326MO-100, CSB-CF017326MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (P2Y1)(ADP receptor)(Purinergic receptor),CSB-PR2024
Molecular Weight: 48.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P49650
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-373aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPL