Recombinant Mouse Phospholipase D3 (Pld3)
Catalog Number:
CSB-CF018146MO
- Images (0)
| Article Name: | Recombinant Mouse Phospholipase D3 (Pld3) |
| Biozol Catalog Number: | CSB-CF018146MO |
| Supplier Catalog Number: | CSB-CF018146MO |
| Alternative Catalog Number: | CSB-CF018146MO-100, CSB-CF018146MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3),CSB-PR2024 |
| Molecular Weight: | 58.2 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O35405 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-488aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQ |
Product Guarantee and Expert Support
