Recombinant Rat Peripheral myelin protein 22 (Pmp22)
Catalog Number:
CSB-CF018241RA
- Images (0)
| Article Name: | Recombinant Rat Peripheral myelin protein 22 (Pmp22) |
| Biozol Catalog Number: | CSB-CF018241RA |
| Supplier Catalog Number: | CSB-CF018241RA |
| Alternative Catalog Number: | CSB-CF018241RA-100, CSB-CF018241RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22) |
| Molecular Weight: | 23.4 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P25094 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-160aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE |
Product Guarantee and Expert Support
