Recombinant Human Bone marrow proteoglycan (PRG2), partial
Catalog Number:
CSB-CF018670HUA2
- Images (0)
| Article Name: | Recombinant Human Bone marrow proteoglycan (PRG2), partial |
| Biozol Catalog Number: | CSB-CF018670HUA2 |
| Supplier Catalog Number: | CSB-CF018670HUa2 |
| Alternative Catalog Number: | CSB-CF018670HUA2-100, CSB-CF018670HUA2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein,CSB-PR2024 |
| Molecular Weight: | 29.8 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P13727 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 106-222aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY |
Product Guarantee and Expert Support
