Recombinant Human Prolactin receptor (PRLR)

Product Overview

• Article Name: Recombinant Human Prolactin receptor (PRLR)
• Biozol Catalog Number: CSB-CF018727HU
• Supplier Catalog Number: CSB-CF018727HU
• Alternative Catalog Number: CSB-CF018727HU-100, CSB-CF018727HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 truncated prolactin receptor , Delta 4-SF1b truncated prolactin receptor , HPRL, hPRL receptor, hPRLrI, Lactogen receptor, MFAB, MGC105486, OPR, OTTHUMP00000115998 , Pr-1, Pr-3, PRL R, PRL-R, PRLR, Prlr-r

Product Properties

• Molecular Weight: 71.9 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P16471
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: in vitro E.coli expression system
• Expression System: 25-622aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKG