Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial
Catalog Number:
CSB-CF021679HU1
- Images (0)
| Article Name: | Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial |
| Biozol Catalog Number: | CSB-CF021679HU1 |
| Supplier Catalog Number: | CSB-CF021679HU1 |
| Alternative Catalog Number: | CSB-CF021679HU1-100, CSB-CF021679HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2 |
| Molecular Weight: | 30.5 kDa |
| Tag: | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| UniProt: | P31639 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-102aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA |
Product Guarantee and Expert Support
