Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1)

Catalog Number: CSB-CF022653HU
Article Name: Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1)
Biozol Catalog Number: CSB-CF022653HU
Supplier Catalog Number: CSB-CF022653HU
Alternative Catalog Number: CSB-CF022653HU-100, CSB-CF022653HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: SR type 1,Steroid 5-alpha-reductase 1,S5AR 1
Molecular Weight: 32.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P18405
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 1-259aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKII