Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)
Catalog Number:
CSB-CF022759HU
- Images (0)
| Article Name: | Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1) |
| Biozol Catalog Number: | CSB-CF022759HU |
| Supplier Catalog Number: | CSB-CF022759HU |
| Alternative Catalog Number: | CSB-CF022759HU-100, CSB-CF022759HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I |
| Molecular Weight: | 52.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P15907 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-406aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGIL |
Product Guarantee and Expert Support
