Recombinant Human Toll-like receptor 10 (TLR10), partial

Catalog Number: CSB-CF023600HUB3
Article Name: Recombinant Human Toll-like receptor 10 (TLR10), partial
Biozol Catalog Number: CSB-CF023600HUB3
Supplier Catalog Number: CSB-CF023600HUb3
Alternative Catalog Number: CSB-CF023600HUB3-100, CSB-CF023600HUB3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CD_antigen: CD290,CSB-PR2024
Molecular Weight: 84.6 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: Q9BXR5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 20-576aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEH