Recombinant Human Transmembrane protein 158 (TMEM158)
Catalog Number:
CSB-CF023732HU
- Images (0)
| Article Name: | Recombinant Human Transmembrane protein 158 (TMEM158) |
| Biozol Catalog Number: | CSB-CF023732HU |
| Supplier Catalog Number: | CSB-CF023732HU |
| Alternative Catalog Number: | CSB-CF023732HU-100, CSB-CF023732HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (40 kDa BINP-binding protein)(p40BBP)(Ras-induced senescence protein 1),CSB-PR2024 |
| Molecular Weight: | 29.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q8WZ71 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 21-300aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAAAAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVP |
Product Guarantee and Expert Support
