Recombinant Mouse Stimulator of interferon genes protein (Sting1)
Catalog Number:
CSB-CF023754MO
- Images (0)
| Article Name: | Recombinant Mouse Stimulator of interferon genes protein (Sting1) |
| Biozol Catalog Number: | CSB-CF023754MO |
| Supplier Catalog Number: | CSB-CF023754MO |
| Alternative Catalog Number: | CSB-CF023754MO-100, CSB-CF023754MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | mSTING (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (Transmembrane protein 173) (Eris) (Mita) (Mpys) (Sting) |
| Molecular Weight: | 48.9 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q3TBT3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-378aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAG |
Product Guarantee and Expert Support
