Recombinant Rat Thyrotropin receptor (Tshr)

Catalog Number: CSB-CF025131RA
Article Name: Recombinant Rat Thyrotropin receptor (Tshr)
Biozol Catalog Number: CSB-CF025131RA
Supplier Catalog Number: CSB-CF025131RA
Alternative Catalog Number: CSB-CF025131RA-100, CSB-CF025131RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Thyroid-stimulating hormone receptor,TSH-R
Molecular Weight: 85.7 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P21463
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 22-764aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RGCTSPPCECHQEDDFRVTCKELHQIPSLPPSTQTLKLIETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPDALTELPLLKFLGIFNTGLRIFPDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSIQGHAFNGTKLDAVYLNKNKYLTAIDKDAFGGVYSGPTLLDVSSTSVTALPSKGLEHLKELIAKNTWTLKKLPLSLSFLHLTRA
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration